PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G113300.6
Common NameB456_007G113300, LOC105802851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 235aa    MW: 27095.8 Da    PI: 6.8673
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G113300.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH32.31.8e-10200229130
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPka 30 
                         +r++h ++Er+RR+++N+ ++ Lr+l+P++
  Gorai.007G113300.6 200 QRMTHIAVERNRRRQMNDYLNSLRSLMPPC 229
                         79**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474595.67E-9192230IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.21E-7198233No hitNo description
Gene3DG3DSA:4.10.280.106.3E-9198231IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.379199234IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.4E-8200229IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MERLQGPINP YFLGEHLEVE CLEQGFISCE RLKLGEEEEE EAHFSIPSFE EKMPFLQMLQ  60
SVESPQLFAF KEPNFQTLLR LQHMKKPWEL NTNPFIPEME TQVQALELES CVTHETVLDL  120
HSPVKSETKE LKKSPPSSSC AEVLSSGSNQ HQPKSDNCSG EPNLGSSPQK IFTKSPPITR  180
ERRKRKRTKA AKNKEEVESQ RMTHIAVERN RRRQMNDYLN SLRSLMPPCY IQRV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181186RRKRKR
2200211RMTHIAVERNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490188.11e-172PREDICTED: transcription factor bHLH67-like isoform X1
TrEMBLA0A0D2SBI31e-172A0A0D2SBI3_G
STRINGPOPTR_0014s10190.12e-72(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61950.18e-31bHLH family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]